New Arrivals are Here-Fast Shipping from Our USA Warehouse

SARS-CoV-2 (COVID-19) S protein, His-Tag, stabilized trimer Size:100µg Performance of cleavage conditions can

$215.00

Quantity
Description

Performance of cleavage conditions can be easily controlled and visualized by SDS-PAGE using the Cleavage and tag control protein

Sequence without tags (AA 30-390):MELVKRKRIEAIRGQILSKLRLASPPSQGEVPPGP

It is the major processing enzyme of the secretory pathway and is localized in the trans-golgi network where it functions to cleave other proteins into their mature/active forms

It is recommended to improve cleavage efficiency for each fusion protein by varying the amount of recombinant blueTEV

SARS-CoV-2 (COVID-19) S protein, His-Tag, stabilized trimer Size:100µg Performance of cleavage conditions canRecombinant Spike protein of SARS CoV 2 (COVID 19) from Wuhan pneumonia virus with C terminal Strep and His Tag as a stabilized trimer and with deletion of the internal Furin site. The S protein plays key parts in the induction of neutralizing antibody and T cell responses, as well as protective immunity. Overview Product Name: SARS CoV 2 (COVID 19) S protein, His Tag, stabilized trimer Catalog No.: P2020 025 RefSeq Links: NC_045512. 2; MN908947. 3;

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.

View More

  • Product more
  • Collection:

You may also like

recommand products

50$ Store Credit
Your message