New Arrivals are Here-Fast Shipping from Our USA Warehouse

SARS-CoV-2 (COVID-19) Spike S1 Protein (RBD), GFP/His-Tag Species_Tobaco Etch Virus remdesivir (Veklury®) has a pivotal

$245.00

Quantity
Description

remdesivir (Veklury®) has a pivotal role in COVID-19 therapy

VLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Product Name: Catalase

elastases hydrolyze many proteins in addition to elastin

SARS-CoV-2 (COVID-19) Spike S1 Protein (RBD), GFP/His-Tag Species_Tobaco Etch Virus remdesivir (Veklury®) has a pivotalRecombinant protein of the receptor binding domain (RBD) of SARS CoV 2 (COVID 2019) Spike S1 from Wuhan pneumonia virus with N terminal His Tag and C terminal GFP + His Tag. Overview Product Name: SARS CoV 2 (COVID 19) Spike S1 Protein (RBD), GFP His Tag Catalog No.: P2020 031 RefSeq Links: NC_045512. 2; MN908947. 3; YP_009724390. 1; QHD43416. 1; GeneID: 43740568; UniProt: P0DTC2 Synonyms: SARS CoV 2; coronavirus; SARS CoV 2 spike RBD; SARS CoV 2

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.

View More

  • Product more
  • Collection:

You may also like

recommand products

50$ Store Credit
Your message