SARS-CoV-2 (COVID-19) S protein, His-Tag, stabilized trimer Size:100µg

SARS-CoV-2 (COVID-19) S protein, His-Tag, stabilized trimer Size:100µgRecombinant Spike protein of SARS CoV 2 (COVID 19) from Wuhan pneumonia virus with C terminal Strep and His Tag as a stabilized trimer and with deletion of the internal Furin site. The S protein plays key parts in the induction of neutralizing antibody and T cell responses, as well as protective immunity. Overview Product Name: SARS CoV 2 (COVID 19) S protein, His Tag, stabilized trimer Catalog No.: P2020 025 RefSeq Links: NC_045512. 2; MN908947. 3;

including tissue morphogenesis and repair

It is recommended to improve cleavage efficiency for each fusion protein by varying the amount of recombinant blueTEV

inactive variant S217A

Product Name: human Interleukin-4

bronchial epithelial cells

BAFF has emerged as a promising therapeutic target for the treatment of autoimmune disorders and B-cell malignancies

and pharmacokinetic profiles

Performance of cleavage conditions can be easily controlled and visualized by SDS-PAGE using the Cleavage and tag control protein

Sequence without tags (AA 30-390):MELVKRKRIEAIRGQILSKLRLASPPSQGEVPPGP

It is the major processing enzyme of the secretory pathway and is localized in the trans-golgi network where it functions to cleave other proteins into their mature/active forms

Download Product Information for SARS-CoV-2 S1 (RBD) Omicron B

1 lineage) emerged in Brazil